PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000167639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 341aa    MW: 38466.5 Da    PI: 5.8012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000167639genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-143077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l  +    G g+W+ +ar  g+ R++k+c++rw +yl
    MDP0000167639 30 KGLWSPEEDEKLMXYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 77
                     678*******************************************97 PP

2Myb_DNA-binding506.7e-1683126146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++ +  lG++ W+ Ia++++ gRt++++k++w++
    MDP0000167639  83 RGAFSPQEEELIIHFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 126
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.272577IPR017930Myb domain
SuperFamilySSF466899.77E-2828124IPR009057Homeodomain-like
SMARTSM007173.9E-102979IPR001005SANT/Myb domain
PfamPF002494.5E-133077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-233184IPR009057Homeodomain-like
CDDcd001671.17E-83377No hitNo description
PROSITE profilePS5129425.14478132IPR017930Myb domain
SMARTSM007172.4E-1582130IPR001005SANT/Myb domain
PfamPF002491.1E-1483126IPR001005SANT/Myb domain
CDDcd001674.47E-1185125No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2585133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MRKPESIGKD DVDGAKTINK KKMMMSKLRK GLWSPEEDEK LMXYMLTNGQ GCWSDVARNA  60
GLQRCGKSCR LRWINYLRPD LKRGAFSPQE EELIIHFHSI LGNRWSQIAA RLPGRTDNEI  120
KNFWNSALKK RLKNNNMSTS TSSPNDSDSS DPRDPVVGGT FMPMHDHDMM TMYNMDSSSS  180
SSTSMQAMAV XSNTLFNPFY MLDNRYDMAH ADDVVVNPTC FPHLPNIGDN QGHYGDYGNL  240
EGGHKMGLEG DLFLPPLESR SIKNNLNGQL VADNISNKNS SINNYHFHNS CFNNTELIGF  300
KVDEEEDMFG FGNINGGQGE NVRVGEWDFE GFMLDTSSFL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-2751322128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9703572e-75AY970357.1 Prunus salicina clone PSX08 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356737.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_008375175.10.0PREDICTED: transcription factor MYB46-like
TrEMBLM5XMW61e-172M5XMW6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-70myb domain protein 46